PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00773_0030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family LFY
Protein Properties Length: 495aa    MW: 55161.8 Da    PI: 7.647
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00773_0030genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY264.93.1e-8114147228383
        FLO_LFY  28 eeaavseapleaaaaaaark.lreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrlee 122
                    ++++++++++++a+aa++ +  r +++l+k+yGvr  t++++ e Gf  +tL+ m+dee+ + +k +++   + +lvGer+G+k a r+ r++lee
  kfl00773_0030 141 SQQHLTTQTQQVASAAEQFDdSRVMNDLLKDYGVREHTISRMEEEGFNLNTLLSMNDEEVAEAIKMMISECGIKFLVGERFGVKMACRSGRKWLEE 236
                    33344444444444444444599************************************************************************* PP

        FLO_LFY 123 eeaekkrrkll.sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeedede 217
                    ++a  +      s+++++ ld  +++g+se   ++     ++gg g +e+e + +e  +  +++++  + ++k k+                 + +
  kfl00773_0030 237 KRALLENPPAPqSQKKRKRLDGKASQGVSEHVLASL----VNGGLG-NESEEADEE--TV-QKQSEL-SGRTKSKT-----------------TPK 306
                    775555443332555556899999999988765442....222222.111111111..11.111111.11111111.................122 PP

        FLO_LFY 218 egsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhc 313
                    +++ge+ e  +r   f vt  ge  +gkk GLDYLf+Ly + ++ L +++   k  G+k  +kv n v+ryak+ g  +inkPkmr+Y hCYalhc
  kfl00773_0030 307 KKKGEGDEATSRGPAFQVTAQGEDGHGKKQGLDYLFELYGEAGRILEEIRVQEKATGKKPSAKVNNLVYRYAKQRGMGFINKPKMRQYLHCYALHC 402
                    334555556778899********************************************************************************* PP

        FLO_LFY 314 LdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlers 383
                    Ld  +sna+r + ++r+    aw + cy+pl+++a+ +g++++++f+  p+L+iW vP +L +LC  e+ 
  kfl00773_0030 403 LDPGTSNAIRMTCRDRKKTLQAWAECCYEPLLQMARVRGYNLESLFQLSPQLAIWNVPKQLEKLCEEEKD 472
                    *****************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.4E-70151472IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MQGHGLAGFR DQDSLQQSLD ISNQSFHRDS LRDQAYFQNV LQSSLQSHAL QSHSLQSLQN  60
HGLQSHSLQN NSLQSHGLQS HSSLQSQALQ AMGLQTPEAQ SLGIANQGAH NPTSYLSQEN  120
SILPHSFNHQ FQVQQAGGLG SQQHLTTQTQ QVASAAEQFD DSRVMNDLLK DYGVREHTIS  180
RMEEEGFNLN TLLSMNDEEV AEAIKMMISE CGIKFLVGER FGVKMACRSG RKWLEEKRAL  240
LENPPAPQSQ KKRKRLDGKA SQGVSEHVLA SLVNGGLGNE SEEADEETVQ KQSELSGRTK  300
SKTTPKKKKG EGDEATSRGP AFQVTAQGED GHGKKQGLDY LFELYGEAGR ILEEIRVQEK  360
ATGKKPSAKV NNLVYRYAKQ RGMGFINKPK MRQYLHCYAL HCLDPGTSNA IRMTCRDRKK  420
TLQAWAECCY EPLLQMARVR GYNLESLFQL SPQLAIWNVP KQLEKLCEEE KDRLGELGSG  480
QLDQQPLPPP PRQGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_B3e-463104756171FLORICAULA/LEAFY HOMOLOG 1
4bhk_A3e-463104756171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2695350.0KF269535.1 Klebsormidium subtile KsLFY mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW8EHH90.0W8EHH9_9VIRI; KsLFY
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70181619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-43floral meristem identity control protein LEAFY (LFY)